| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily) multihelical; consists of a conserved 4-helical core and a variable insert subdomain |
Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) ![]() |
| Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (6 proteins) |
| Protein automated matches [254474] (3 species) not a true protein |
| Species Thermus thermophilus [TaxId:274] [255020] (2 PDB entries) |
| Domain d5tmff1: 5tmf F:73-257 [326509] Other proteins in same PDB: d5tmfc_, d5tmfd_, d5tmfe_, d5tmff2, d5tmff3 automated match to d1smyf3 complexed with mg, ne6, po4, zn |
PDB Entry: 5tmf (more details), 3 Å
SCOPe Domain Sequences for d5tmff1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tmff1 a.177.1.1 (F:73-257) automated matches {Thermus thermophilus [TaxId: 274]}
pkistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvr
akilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanl
rlvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraia
dqart
Timeline for d5tmff1: