![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) ![]() |
![]() | Family a.4.13.0: automated matches [254211] (1 protein) not a true family |
![]() | Protein automated matches [254475] (4 species) not a true protein |
![]() | Species Thermus thermophilus [TaxId:274] [255021] (2 PDB entries) |
![]() | Domain d5tmff3: 5tmf F:319-423 [326511] Other proteins in same PDB: d5tmfc_, d5tmfd_, d5tmfe_, d5tmff1 automated match to d1smyf2 complexed with mg, ne6, po4, zn |
PDB Entry: 5tmf (more details), 3 Å
SCOPe Domain Sequences for d5tmff3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tmff3 a.4.13.0 (F:319-423) automated matches {Thermus thermophilus [TaxId: 274]} tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg rehtleevgaffgvtrerirqienkalrklkyhesrtrklrdfld
Timeline for d5tmff3: