SCOPe 2.07: Domain d5tmff3: 5tmf F:319-423

Lineage for d5tmff3 (5tmf F:319-423)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families)

5. Family a.4.13.0: automated matches [254211] (1 protein)
   not a true family

6. Protein automated matches [254475] (3 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [255021] (2 PDB entries)

8. Domain d5tmff3: 5tmf F:319-423 [326511]
   Other proteins in same PDB: d5tmfc_, d5tmfd_, d5tmfe_, d5tmff1
   automated match to d1smyf2
   complexed with mg, ne6, po4, zn

Details for d5tmff3

PDB Entry: 5tmf, 3 Å

PDB Description: re-refinement of thermus thermophilus rna polymerase

PDB Compounds: (F:) RNA polymerase sigma factor SigA

SCOPe Domain Sequences for d5tmff3:

Sequence; same for both SEQRES and ATOM records:

>d5tmff3 a.4.13.0 (F:319-423) automated matches {Thermus thermophilus [TaxId: 274]}
tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg
rehtleevgaffgvtrerirqienkalrklkyhesrtrklrdfld

Timeline for d5tmff3:

• d5tmff3 first appeared in SCOPe 2.06