SCOPe 2.07: Domain d5tmff1: 5tmf F:73-257

Lineage for d5tmff1 (5tmf F:73-257)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
   multihelical; consists of a conserved 4-helical core and a variable insert subdomain

4. Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families)

5. Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (6 proteins)

6. Protein automated matches [254474] (3 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [255020] (2 PDB entries)

8. Domain d5tmff1: 5tmf F:73-257 [326509]
   Other proteins in same PDB: d5tmfc_, d5tmfd_, d5tmfe_, d5tmff2, d5tmff3
   automated match to d1smyf3
   complexed with mg, ne6, po4, zn

Details for d5tmff1

PDB Entry: 5tmf, 3 Å

PDB Description: re-refinement of thermus thermophilus rna polymerase

PDB Compounds: (F:) RNA polymerase sigma factor SigA

SCOPe Domain Sequences for d5tmff1:

Sequence; same for both SEQRES and ATOM records:

>d5tmff1 a.177.1.1 (F:73-257) automated matches {Thermus thermophilus [TaxId: 274]}
pkistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvr
akilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanl
rlvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraia
dqart

Timeline for d5tmff1:

• d5tmff1 first appeared in SCOPe 2.06
  
• d5tmff1 appears in the current release, SCOPe 2.08