| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) ![]() the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
| Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins) 4 helices; irregular array |
| Protein automated matches [257263] (3 species) not a true protein |
| Species Thermus thermophilus [TaxId:274] [326512] (1 PDB entry) |
| Domain d5tmfe_: 5tmf E: [326513] Other proteins in same PDB: d5tmfc_, d5tmfd_, d5tmff1, d5tmff2, d5tmff3 automated match to d1i6ve_ complexed with mg, ne6, po4, zn |
PDB Entry: 5tmf (more details), 3 Å
SCOPe Domain Sequences for d5tmfe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tmfe_ a.143.1.1 (E:) automated matches {Thermus thermophilus [TaxId: 274]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
twamkelltgrlvfgenlvpedrlqkemeriypge
Timeline for d5tmfe_: