Lineage for d5tmff1 (5tmf F:73-257)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2018296Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
    multihelical; consists of a conserved 4-helical core and a variable insert subdomain
  4. 2018297Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) (S)
  5. 2018298Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (6 proteins)
  6. 2018341Protein automated matches [254474] (3 species)
    not a true protein
  7. Species Thermus thermophilus [TaxId:274] [255020] (2 PDB entries)
  8. 2018346Domain d5tmff1: 5tmf F:73-257 [326509]
    Other proteins in same PDB: d5tmfc_, d5tmfd_, d5tmfe_, d5tmff2, d5tmff3
    automated match to d1smyf3
    complexed with mg, ne6, po4, zn

Details for d5tmff1

PDB Entry: 5tmf (more details), 3 Å

PDB Description: re-refinement of thermus thermophilus rna polymerase
PDB Compounds: (F:) RNA polymerase sigma factor SigA

SCOPe Domain Sequences for d5tmff1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tmff1 a.177.1.1 (F:73-257) automated matches {Thermus thermophilus [TaxId: 274]}
pkistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvr
akilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanl
rlvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraia
dqart

SCOPe Domain Coordinates for d5tmff1:

Click to download the PDB-style file with coordinates for d5tmff1.
(The format of our PDB-style files is described here.)

Timeline for d5tmff1: