Lineage for d5jkmb_ (5jkm B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2704097Species Human (Homo sapiens) [TaxId:9606] [255624] (13 PDB entries)
  8. 2704182Domain d5jkmb_: 5jkm B: [324488]
    automated match to d3a9qe_
    complexed with fe, gol, mg

Details for d5jkmb_

PDB Entry: 5jkm (more details), 1.8 Å

PDB Description: binary crystal structure of positively and negatively supercharged variants ftn(pos) and ftn(neg) from human heavy chain ferritin (mg acetate condition)
PDB Compounds: (B:) ferritin heavy chain

SCOPe Domain Sequences for d5jkmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jkmb_ a.25.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsqvrqnyhqdsekainrqirlelyasyvylsmsyyfdrddvalknfakyflhqsheere
haeklmklqnqrggriflqdiqkpdkddwesglramekalklekkvnqsllelhklatkk
ndphlcdfiethylneqvkaikelgdhvtnlrkmgaprsglaeylfdkhtlg

SCOPe Domain Coordinates for d5jkmb_:

Click to download the PDB-style file with coordinates for d5jkmb_.
(The format of our PDB-style files is described here.)

Timeline for d5jkmb_: