Lineage for d5jkml_ (5jkm L:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312408Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2312409Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314636Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2314637Protein automated matches [190036] (42 species)
    not a true protein
  7. 2314777Species Human (Homo sapiens) [TaxId:9606] [255624] (9 PDB entries)
  8. 2314811Domain d5jkml_: 5jkm L: [324473]
    automated match to d3a9qe_
    complexed with fe, gol, mg

Details for d5jkml_

PDB Entry: 5jkm (more details), 1.8 Å

PDB Description: binary crystal structure of positively and negatively supercharged variants ftn(pos) and ftn(neg) from human heavy chain ferritin (mg acetate condition)
PDB Compounds: (L:) ferritin heavy chain

SCOPe Domain Sequences for d5jkml_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jkml_ a.25.1.0 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsqvrqnyhqdseeainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
haeklmklqnqrggriflqdiqkpdeddwesglnameealeleknvnqsllelhklatdk
ndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg

SCOPe Domain Coordinates for d5jkml_:

Click to download the PDB-style file with coordinates for d5jkml_.
(The format of our PDB-style files is described here.)

Timeline for d5jkml_: