| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
| Protein automated matches [190036] (60 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255624] (13 PDB entries) |
| Domain d5jkmf_: 5jkm F: [324505] automated match to d3a9qe_ complexed with fe, gol, mg |
PDB Entry: 5jkm (more details), 1.8 Å
SCOPe Domain Sequences for d5jkmf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jkmf_ a.25.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsqvrqnyhqdsekainrqirlelyasyvylsmsyyfdrddvalknfakyflhqsheere
haeklmklqnqrggriflqdiqkpdkddwesglramekalklekkvnqsllelhklatkk
ndphlcdfiethylneqvkaikelgdhvtnlrkmgaprsglaeylfdkhtlg
Timeline for d5jkmf_: