Lineage for d3a9qe_ (3a9q E:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. Protein automated matches [190036] (58 species)
    not a true protein
  7. Species Soybean (Glycine max) [TaxId:3847] [255741] (4 PDB entries)
  8. Domain d3a9qe_: 3a9q E: [245073]
    automated match to d3shxa_
    complexed with acy, ca

Details for d3a9qe_

PDB Entry: 3a9q (more details), 1.9 Å

PDB Description: Crystal Structure Analysis of E173A variant of the soybean ferritin SFER4
PDB Compounds: (E:) Ferritin-4, chloroplastic

SCOPe Domain Sequences for d3a9qe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a9qe_ a.25.1.0 (E:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
tvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrdnvalrglakffkesse
eerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalhamelalslekltneklln
lhsvatkngdvqladfveteylgaqveaikriseyvaqlrrvgkghgvwhfdqmllhe

SCOPe Domain Coordinates for d3a9qe_ are not available.

Timeline for d3a9qe_: