SCOPe 2.08: Domain d5ksab2: 5ksa B:93-191

Lineage for d5ksab2 (5ksa B:93-191)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5ksab2: 5ksa B:93-191 [323019]
   Other proteins in same PDB: d5ksaa1, d5ksaa2, d5ksab1, d5ksac2, d5ksad2
   automated match to d1sebb1
   complexed with ca, nag

Details for d5ksab2

PDB Entry: 5ksa, 2 Å

PDB Description: bel602-dq8.5-glia-gamma1 complex

PDB Compounds: (B:) HLA class II histocompatibility antigen, DQ beta 1 chain

SCOPe Domain Sequences for d5ksab2:

Sequence; same for both SEQRES and ATOM records:

>d5ksab2 b.1.1.0 (B:93-191) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrveptvtispsrtealnhhnllvcsvtdfypaqikvrwfrndqeettgvvstplirngd
wtfqilvmlemtpqrgdvytchvehpslqnpiivewraq

Timeline for d5ksab2:

• d5ksab2 first appeared in SCOPe 2.06
  
• d5ksab2 appears in SCOPe 2.07