Lineage for d5ksaa1 (5ksa A:0-81)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. Protein automated matches [226842] (5 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [226044] (105 PDB entries)
  8. Domain d5ksaa1: 5ksa A:0-81 [323032]
    Other proteins in same PDB: d5ksaa2, d5ksab2, d5ksac1, d5ksac2, d5ksad1, d5ksad2
    automated match to d4ozfa1
    complexed with ca, nag

Details for d5ksaa1

PDB Entry: 5ksa (more details), 2 Å

PDB Description: bel602-dq8.5-glia-gamma1 complex
PDB Compounds: (A:) HLA class II histocompatibility antigen, DQ alpha 1 chain

SCOPe Domain Sequences for d5ksaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ksaa1 d.19.1.0 (A:0-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwslpvlrqfrfdpqfa
ltniavlkhnlnslikrsnsta

SCOPe Domain Coordinates for d5ksaa1 are not available.

Timeline for d5ksaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ksaa2
View in 3D
Domains from other chains:
(mouse over for more information)
d5ksab1, d5ksab2, d5ksac1, d5ksac2, d5ksad1, d5ksad2