SCOPe 2.08: Domain d5ksaa1: 5ksa A:0-81

Lineage for d5ksaa1 (5ksa A:0-81)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)

8. Domain d5ksaa1: 5ksa A:0-81 [323032]
   Other proteins in same PDB: d5ksaa2, d5ksab2, d5ksac1, d5ksac2, d5ksad1, d5ksad2
   automated match to d4ozfa1
   complexed with ca, nag

Details for d5ksaa1

PDB Entry: 5ksa, 2 Å

PDB Description: bel602-dq8.5-glia-gamma1 complex

PDB Compounds: (A:) HLA class II histocompatibility antigen, DQ alpha 1 chain

SCOPe Domain Sequences for d5ksaa1:

Sequence; same for both SEQRES and ATOM records:

>d5ksaa1 d.19.1.0 (A:0-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwslpvlrqfrfdpqfa
ltniavlkhnlnslikrsnsta

Timeline for d5ksaa1:

• d5ksaa1 first appeared in SCOPe 2.06
  
• d5ksaa1 appears in SCOPe 2.07