Lineage for d5ksab1 (5ksa B:2-92)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938673Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)
  8. 2938711Domain d5ksab1: 5ksa B:2-92 [323018]
    Other proteins in same PDB: d5ksaa2, d5ksab2, d5ksac1, d5ksac2, d5ksad1, d5ksad2
    automated match to d1klub2
    complexed with ca, nag

Details for d5ksab1

PDB Entry: 5ksa (more details), 2 Å

PDB Description: bel602-dq8.5-glia-gamma1 complex
PDB Compounds: (B:) HLA class II histocompatibility antigen, DQ beta 1 chain

SCOPe Domain Sequences for d5ksab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ksab1 d.19.1.0 (B:2-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dspedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeyw
nsqkevlertraeldtvcrhnyqlelrttlq

SCOPe Domain Coordinates for d5ksab1:

Click to download the PDB-style file with coordinates for d5ksab1.
(The format of our PDB-style files is described here.)

Timeline for d5ksab1: