SCOPe 2.08: Domain d5ksac2: 5ksa C:130-212

Lineage for d5ksac2 (5ksa C:130-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5ksac2: 5ksa C:130-212 [323046]
   Other proteins in same PDB: d5ksaa1, d5ksab1, d5ksab2, d5ksac1, d5ksad1
   automated match to d2pyfa2
   complexed with ca, nag

Details for d5ksac2

PDB Entry: 5ksa, 2 Å

PDB Description: bel602-dq8.5-glia-gamma1 complex

PDB Compounds: (C:) Bel602 alpha TRAV20*01

SCOPe Domain Sequences for d5ksac2:

Sequence; same for both SEQRES and ATOM records:

>d5ksac2 b.1.1.2 (C:130-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipe

Timeline for d5ksac2:

• d5ksac2 first appeared in SCOPe 2.06
  
• d5ksac2 appears in SCOPe 2.07