Lineage for d5ksad1 (5ksa D:3-129)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. Protein automated matches [190740] (30 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1747 PDB entries)
  8. Domain d5ksad1: 5ksa D:3-129 [323120]
    Other proteins in same PDB: d5ksaa1, d5ksaa2, d5ksab1, d5ksac2, d5ksad2
    automated match to d3of6c1
    complexed with ca, nag

Details for d5ksad1

PDB Entry: 5ksa (more details), 2 Å

PDB Description: bel602-dq8.5-glia-gamma1 complex
PDB Compounds: (D:) Bel602 beta TRBV9*01

SCOPe Domain Sequences for d5ksad1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ksad1 b.1.1.0 (D:3-129) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvtqtpkhlitatgqrvtlrcsprsgdlsvywyqqsldqglqfliqyyngeerakgnile
rfsaqqfpdlhselnlsslelgdsalyfcassvagtpsyeqyfgpgtrltvted

SCOPe Domain Coordinates for d5ksad1 are not available.

Timeline for d5ksad1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ksad2
View in 3D
Domains from other chains:
(mouse over for more information)
d5ksaa1, d5ksaa2, d5ksab1, d5ksab2, d5ksac1, d5ksac2