Lineage for d5ksaa2 (5ksa A:82-181)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. Protein automated matches [190374] (15 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1239 PDB entries)
  8. Domain d5ksaa2: 5ksa A:82-181 [323033]
    Other proteins in same PDB: d5ksaa1, d5ksab1, d5ksab2, d5ksac1, d5ksad1
    automated match to d4ozfa2
    complexed with ca, nag

Details for d5ksaa2

PDB Entry: 5ksa (more details), 2 Å

PDB Description: bel602-dq8.5-glia-gamma1 complex
PDB Compounds: (A:) HLA class II histocompatibility antigen, DQ alpha 1 chain

SCOPe Domain Sequences for d5ksaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ksaa2 b.1.1.2 (A:82-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atnevpevtvfskspvtlgqpniliclvdnifppvvnitwlsnghsvtegvsetsflsks
dhsffkisyltllpsaeesydckvehwgldkpllkhwepe

SCOPe Domain Coordinates for d5ksaa2 are not available.

Timeline for d5ksaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ksaa1
View in 3D
Domains from other chains:
(mouse over for more information)
d5ksab1, d5ksab2, d5ksac1, d5ksac2, d5ksad1, d5ksad2