Lineage for d5ksab2 (5ksa B:93-191)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.0: automated matches [191470] (1 protein)
not a true familyProtein automated matches [190740] (29 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) 
Domain d5ksab2: 5ksa B:93-191 [323019]
Other proteins in same PDB: d5ksaa1, d5ksaa2, d5ksab1, d5ksac2, d5ksad2
automated match to d1sebb1
complexed with ca, nag
Details for d5ksab2
PDB Entry: 5ksa (more details), 2 Å
PDB Description: bel602-dq8.5-glia-gamma1 complex
PDB Compounds: (B:) HLA class II histocompatibility antigen, DQ beta 1 chainSCOPe Domain Sequences for d5ksab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ksab2 b.1.1.0 (B:93-191) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrveptvtispsrtealnhhnllvcsvtdfypaqikvrwfrndqeettgvvstplirngd
wtfqilvmlemtpqrgdvytchvehpslqnpiivewraq
SCOPe Domain Coordinates for d5ksab2:
Click to download the PDB-style file with coordinates for d5ksab2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5ksab2:
View in 3D
