![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
![]() | Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) ![]() |
![]() | Family c.37.1.8: G proteins [52592] (20 proteins) |
![]() | Protein Ran [52609] (2 species) |
![]() | Species Dog (Canis familiaris) [TaxId:9615] [52610] (5 PDB entries) |
![]() | Domain d1a2kc_: 1a2k C: [32037] Other proteins in same PDB: d1a2ka_, d1a2kb_ |
PDB Entry: 1a2k (more details), 2.5 Å
SCOP Domain Sequences for d1a2kc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a2kc_ c.37.1.8 (C:) Ran {Dog (Canis familiaris)} qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev vmdpalaaqyehdlev
Timeline for d1a2kc_:
![]() Domains from other chains: (mouse over for more information) d1a2ka_, d1a2kb_, d1a2kd_, d1a2ke_ |