Lineage for d1a2kb_ (1a2k B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30954Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 31064Superfamily d.17.4: NTF2-like [54427] (4 families) (S)
  5. 31085Family d.17.4.2: Nuclear transport factor-2 (NTF2) [54431] (1 protein)
  6. 31086Protein Nuclear transport factor-2 (NTF2) [54432] (1 species)
  7. 31087Species Rat (Rattus norvegicus) [TaxId:10116] [54433] (5 PDB entries)
  8. 31099Domain d1a2kb_: 1a2k B: [38101]
    Other proteins in same PDB: d1a2kc_, d1a2kd_, d1a2ke_

Details for d1a2kb_

PDB Entry: 1a2k (more details), 2.5 Å

PDB Description: gdpran-ntf2 complex

SCOP Domain Sequences for d1a2kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2kb_ d.17.4.2 (B:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus)}
kpiweqigssfiqhyyqlfdndrtqlgaiyidascltwegqqfqgkaaiveklsslpfqk
iqhsitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndmfrlal
hnfg

SCOP Domain Coordinates for d1a2kb_:

Click to download the PDB-style file with coordinates for d1a2kb_.
(The format of our PDB-style files is described here.)

Timeline for d1a2kb_: