Lineage for d1a2kd_ (1a2k D:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23121Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 23278Protein Ran [52609] (2 species)
  7. 23279Species Dog (Canis familiaris) [TaxId:9615] [52610] (5 PDB entries)
  8. 23290Domain d1a2kd_: 1a2k D: [32038]
    Other proteins in same PDB: d1a2ka_, d1a2kb_

Details for d1a2kd_

PDB Entry: 1a2k (more details), 2.5 Å

PDB Description: gdpran-ntf2 complex

SCOP Domain Sequences for d1a2kd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2kd_ c.37.1.8 (D:) Ran {Dog (Canis familiaris)}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
vmdpalaaqyehdlevaqt

SCOP Domain Coordinates for d1a2kd_:

Click to download the PDB-style file with coordinates for d1a2kd_.
(The format of our PDB-style files is described here.)

Timeline for d1a2kd_: