SCOPe 2.08: Domain d1a2kc_: 1a2k C:

Lineage for d1a2kc_ (1a2k C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Ran [52609] (2 species)

7. Species Dog (Canis familiaris) [TaxId:9615] [52610] (9 PDB entries)
   Uniprot P62825

8. Domain d1a2kc_: 1a2k C: [32037]
   Other proteins in same PDB: d1a2ka_, d1a2kb_
   complexed with gdp, mg, so4
   has additional insertions and/or extensions that are not grouped together

Details for d1a2kc_

PDB Entry: 1a2k, 2.5 Å

PDB Description: gdpran-ntf2 complex

PDB Compounds: (C:) ran

SCOPe Domain Sequences for d1a2kc_:

Sequence; same for both SEQRES and ATOM records:

>d1a2kc_ c.37.1.8 (C:) Ran {Dog (Canis familiaris) [TaxId: 9615]}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
vmdpalaaqyehdlev

Timeline for d1a2kc_:

• d1a2kc_ first appeared (with stable ids) in SCOP 1.55
  
• d1a2kc_ appears in SCOPe 2.07