Lineage for d5jqgc1 (5jqg C:1-245)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) 
automatically mapped to Pfam PF00091Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) 
Protein automated matches [226837] (10 species)
not a true protein
Species Pig (Sus scrofa) [TaxId:9823] [278808] (54 PDB entries) 
Domain d5jqgc1: 5jqg C:1-245 [317556]
Other proteins in same PDB: d5jqga2, d5jqgb1, d5jqgb2, d5jqgc2, d5jqgd1, d5jqgd2, d5jqge_, d5jqgf1, d5jqgf2, d5jqgf3
automated match to d4ihja1
complexed with acp, ca, cl, gdp, gtp, mes, mg
Details for d5jqgc1
PDB Entry: 5jqg (more details), 2.24 Å
PDB Description: an apo tubulin-rb-ttl complex structure used for side-by-side comparison
PDB Compounds: (C:) Tubulin alpha-1B chainSCOPe Domain Sequences for d5jqgc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jqgc1 c.32.1.1 (C:1-245) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd
SCOPe Domain Coordinates for d5jqgc1:
Click to download the PDB-style file with coordinates for d5jqgc1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5jqgc1:
View in 3D
