Lineage for d5jqgb1 (5jqg B:2-243)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2471420Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2471421Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2471422Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2471520Protein Tubulin beta-subunit [52496] (2 species)
  7. 2471535Species Pig (Sus scrofa) [TaxId:9823] [52497] (8 PDB entries)
  8. 2471536Domain d5jqgb1: 5jqg B:2-243 [317590]
    Other proteins in same PDB: d5jqga1, d5jqga2, d5jqgb2, d5jqgc1, d5jqgc2, d5jqgd2, d5jqge_, d5jqgf1, d5jqgf2, d5jqgf3
    automated match to d1sa0b1
    complexed with acp, ca, cl, gdp, gtp, mes, mg

Details for d5jqgb1

PDB Entry: 5jqg (more details), 2.24 Å

PDB Description: an apo tubulin-rb-ttl complex structure used for side-by-side comparison
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d5jqgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jqgb1 c.32.1.1 (B:2-243) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

SCOPe Domain Coordinates for d5jqgb1:

Click to download the PDB-style file with coordinates for d5jqgb1.
(The format of our PDB-style files is described here.)

Timeline for d5jqgb1: