Lineage for d5jqgc2 (5jqg C:246-440)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) 
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) 
Protein automated matches [227071] (7 species)
not a true protein
Species Pig (Sus scrofa) [TaxId:9823] [278816] (54 PDB entries) 
Domain d5jqgc2: 5jqg C:246-440 [317557]
Other proteins in same PDB: d5jqga1, d5jqgb1, d5jqgb2, d5jqgc1, d5jqgd1, d5jqgd2, d5jqge_, d5jqgf1, d5jqgf2, d5jqgf3
automated match to d4i50a2
complexed with acp, ca, cl, gdp, gtp, mes, mg
Details for d5jqgc2
PDB Entry: 5jqg (more details), 2.24 Å
PDB Description: an apo tubulin-rb-ttl complex structure used for side-by-side comparison
PDB Compounds: (C:) Tubulin alpha-1B chainSCOPe Domain Sequences for d5jqgc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jqgc2 d.79.2.1 (C:246-440) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv
SCOPe Domain Coordinates for d5jqgc2:
Click to download the PDB-style file with coordinates for d5jqgc2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5jqgc2:
View in 3D
