Class a: All alpha proteins [46456] (289 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.10: Stathmin [101494] (1 family) single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
Family a.137.10.1: Stathmin [101495] (2 proteins) |
Protein Stathmin 4 [101496] (3 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (178 PDB entries) |
Domain d5jqge_: 5jqg E: [317561] Other proteins in same PDB: d5jqga1, d5jqga2, d5jqgb1, d5jqgb2, d5jqgc1, d5jqgc2, d5jqgd1, d5jqgd2, d5jqgf1, d5jqgf2, d5jqgf3 automated match to d4i55e_ complexed with acp, ca, cl, gdp, gtp, mes, mg |
PDB Entry: 5jqg (more details), 2.24 Å
SCOPe Domain Sequences for d5jqge_:
Sequence, based on SEQRES records: (download)
>d5jqge_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe kdkhaeevrknkelke
>d5jqge_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppdpsleeiqkkleaaeerrkyqeaellkhlaekrehere viqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelke
Timeline for d5jqge_: