| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
| Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
| Protein automated matches [227071] (7 species) not a true protein |
| Species Pig (Sus scrofa) [TaxId:9823] [278816] (54 PDB entries) |
| Domain d5jqga2: 5jqg A:246-437 [317543] Other proteins in same PDB: d5jqga1, d5jqgb1, d5jqgb2, d5jqgc1, d5jqgd1, d5jqgd2, d5jqge_, d5jqgf1, d5jqgf2, d5jqgf3 automated match to d4i50a2 complexed with acp, ca, cl, gdp, gtp, mes, mg |
PDB Entry: 5jqg (more details), 2.24 Å
SCOPe Domain Sequences for d5jqga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jqga2 d.79.2.1 (A:246-437) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgv
Timeline for d5jqga2: