![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) ![]() |
![]() | Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins) Pfam PF03133; PubMed 22020298 |
![]() | Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [311385] (158 PDB entries) |
![]() | Domain d5jqgf3: 5jqg F:77-378 [344295] Other proteins in same PDB: d5jqga1, d5jqga2, d5jqgb1, d5jqgb2, d5jqgc1, d5jqgc2, d5jqgd1, d5jqgd2, d5jqge_, d5jqgf1, d5jqgf2 complexed with acp, ca, cl, gdp, gtp, mes, mg |
PDB Entry: 5jqg (more details), 2.24 Å
SCOPe Domain Sequences for d5jqgf3:
Sequence, based on SEQRES records: (download)
>d5jqgf3 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi kl
>d5jqgf3 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviypgnvwiaksgilisseahviqkylekplllepghr kfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqknygryeegne mffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfgfdfmv deelkvwlievngapacaqklyaelcqgivdvaissvfplasifikl
Timeline for d5jqgf3: