| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
| Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins) N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold |
| Protein Pyruvate oxidase [52476] (2 species) binds FAD |
| Species Lactobacillus plantarum [TaxId:1590] [52477] (8 PDB entries) |
| Domain d1poxb1: 1pox B:183-365 [31732] Other proteins in same PDB: d1poxa2, d1poxa3, d1poxb2, d1poxb3 complexed with fad, gol, mg, na, tpp; mutant |
PDB Entry: 1pox (more details), 2.1 Å
SCOPe Domain Sequences for d1poxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1poxb1 c.31.1.3 (B:183-365) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]}
yasannyqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplm
stypakgivadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntryf
lqididpaklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylas
led
Timeline for d1poxb1: