Lineage for d1poxb1 (1pox B:183-365)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22757Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
  4. 22758Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (4 families) (S)
  5. 22770Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (3 proteins)
  6. 22788Protein Pyruvate oxidase [52476] (1 species)
  7. 22789Species Lactobacillus plantarum [TaxId:1590] [52477] (2 PDB entries)
  8. 22791Domain d1poxb1: 1pox B:183-365 [31732]
    Other proteins in same PDB: d1poxa2, d1poxa3, d1poxb2, d1poxb3

Details for d1poxb1

PDB Entry: 1pox (more details), 2.1 Å

PDB Description: the refined structures of a stabilized mutant and of wild-type pyruvate oxidase from lactobacillus plantarum

SCOP Domain Sequences for d1poxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1poxb1 c.31.1.3 (B:183-365) Pyruvate oxidase {Lactobacillus plantarum}
yasannyqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplm
stypakgivadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntryf
lqididpaklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylas
led

SCOP Domain Coordinates for d1poxb1:

Click to download the PDB-style file with coordinates for d1poxb1.
(The format of our PDB-style files is described here.)

Timeline for d1poxb1: