PDB entry 1pox

View 1pox on RCSB PDB site
Description: the refined structures of a stabilized mutant and of wild-type pyruvate oxidase from lactobacillus plantarum
Class: oxidoreductase(oxygen as acceptor)
Keywords: oxidoreductase(oxygen as acceptor)
Deposited on 1993-11-09, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.162
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyruvate oxidase
    Species: Lactobacillus plantarum [TaxId:1590]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37063 (0-584)
      • conflict (169)
      • conflict (179)
      • conflict (449)
    Domains in SCOPe 2.07: d1poxa1, d1poxa2, d1poxa3
  • Chain 'B':
    Compound: Pyruvate oxidase
    Species: Lactobacillus plantarum [TaxId:1590]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37063 (0-584)
      • conflict (169)
      • conflict (179)
      • conflict (449)
    Domains in SCOPe 2.07: d1poxb1, d1poxb2, d1poxb3
  • Heterogens: MG, NA, TPP, FAD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1poxA (A:)
    tnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrheevgamaaaa
    dakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdtfqemnenp
    iyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqisaedwyasann
    yqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplmstypak
    givadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntryflqidid
    paklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylasledkqe
    gplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfatmgvgipg
    aiaaklnyperqvfnlagdggasmtmqdlvtqvqyhlpvinvvftncqygfikdeqedtn
    qndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvlidavitgdr
    plpaeklrldsamssaadieafkqryeaqdlqplstylkqfgldd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1poxB (B:)
    tnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrheevgamaaaa
    dakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdtfqemnenp
    iyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqisaedwyasann
    yqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplmstypak
    givadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntryflqidid
    paklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylasledkqe
    gplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfatmgvgipg
    aiaaklnyperqvfnlagdggasmtmqdlvtqvqyhlpvinvvftncqygfikdeqedtn
    qndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvlidavitgdr
    plpaeklrldsamssaadieafkqryeaqdlqplstylkqfgldd