| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species) Class I MHC-related |
| Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (15 PDB entries) |
| Domain d4wwkc1: 4wwk C:8-183 [312296] Other proteins in same PDB: d4wwka1, d4wwka2, d4wwkb1, d4wwkb2, d4wwkc2, d4wwkd_ automated match to d1zt4c2 complexed with jls, nag |
PDB Entry: 4wwk (more details), 3.1 Å
SCOPe Domain Sequences for d4wwkc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wwkc1 d.19.1.1 (C:8-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]}
fplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqwetlq
hifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgnasnnffhvafqgkdilsfq
gtsweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk
Timeline for d4wwkc1: