SCOPe 2.08: Domain d4wwkb1: 4wwk B:3-126

Lineage for d4wwkb1 (4wwk B:3-126)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4wwkb1: 4wwk B:3-126 [312483]
   Other proteins in same PDB: d4wwka2, d4wwkc1, d4wwkd_
   automated match to d3q5ya1
   complexed with jls, nag

Details for d4wwkb1

PDB Entry: 4wwk, 3.1 Å

PDB Description: crystal structure of human tcr alpha chain-trav12-3, beta chain-trbv6- 5, antigen-presenting molecule cd1d, and beta-2-microglobulin

PDB Compounds: (B:) TCR Beta Chain-TRBV6-5

SCOPe Domain Sequences for d4wwkb1:

Sequence; same for both SEQRES and ATOM records:

>d4wwkb1 b.1.1.0 (B:3-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevpn
gynvsrsttedfplrllsaapsqtsvyfcassqgpfqpqhfgdgtrlsile

Timeline for d4wwkb1:

• d4wwkb1 first appeared in SCOPe 2.06
  
• d4wwkb1 appears in SCOPe 2.07