SCOPe 2.08: Domain d4wwka2: 4wwk A:131-207

Lineage for d4wwka2 (4wwk A:131-207)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4wwka2: 4wwk A:131-207 [311777]
   Other proteins in same PDB: d4wwka1, d4wwkb1, d4wwkb2, d4wwkc1, d4wwkc2, d4wwkd_
   automated match to d2pyfa2
   complexed with jls, nag

Details for d4wwka2

PDB Entry: 4wwk, 3.1 Å

PDB Description: crystal structure of human tcr alpha chain-trav12-3, beta chain-trbv6- 5, antigen-presenting molecule cd1d, and beta-2-microglobulin

PDB Compounds: (A:) TCR Alpha Chain-TRAV12-3

SCOPe Domain Sequences for d4wwka2:

Sequence; same for both SEQRES and ATOM records:

>d4wwka2 b.1.1.2 (A:131-207) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafn

Timeline for d4wwka2:

• d4wwka2 first appeared in SCOPe 2.06
  
• d4wwka2 appears in SCOPe 2.07