Lineage for d4wwka2 (4wwk A:131-207)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (16 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (983 PDB entries)
  8. 2353783Domain d4wwka2: 4wwk A:131-207 [311777]
    Other proteins in same PDB: d4wwka1, d4wwkb1, d4wwkb2, d4wwkc1, d4wwkc2, d4wwkd_
    automated match to d2pyfa2
    complexed with jls, nag

Details for d4wwka2

PDB Entry: 4wwk (more details), 3.1 Å

PDB Description: crystal structure of human tcr alpha chain-trav12-3, beta chain-trbv6- 5, antigen-presenting molecule cd1d, and beta-2-microglobulin
PDB Compounds: (A:) TCR Alpha Chain-TRAV12-3

SCOPe Domain Sequences for d4wwka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wwka2 b.1.1.2 (A:131-207) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafn

SCOPe Domain Coordinates for d4wwka2:

Click to download the PDB-style file with coordinates for d4wwka2.
(The format of our PDB-style files is described here.)

Timeline for d4wwka2: