Lineage for d4wwka1 (4wwk A:5-130)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (26 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1304 PDB entries)
  8. 2357604Domain d4wwka1: 4wwk A:5-130 [311776]
    Other proteins in same PDB: d4wwka2, d4wwkc1, d4wwkd_
    automated match to d2pyfa1
    complexed with jls, nag

Details for d4wwka1

PDB Entry: 4wwk (more details), 3.1 Å

PDB Description: crystal structure of human tcr alpha chain-trav12-3, beta chain-trbv6- 5, antigen-presenting molecule cd1d, and beta-2-microglobulin
PDB Compounds: (A:) TCR Alpha Chain-TRAV12-3

SCOPe Domain Sequences for d4wwka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wwka1 b.1.1.0 (A:5-130) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eqdpgplsvpegaivslnctysnsafqyfmwyrqysrkgpellmytyssgnkedgrftaq
vdksskyislfirdsqpsdsatylcamsgdlntnagkstfgdgttltvkpn

SCOPe Domain Coordinates for d4wwka1:

Click to download the PDB-style file with coordinates for d4wwka1.
(The format of our PDB-style files is described here.)

Timeline for d4wwka1: