| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species) Class I MHC-related |
| Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (15 PDB entries) |
| Domain d1zt4c2: 1zt4 C:4-183 [144766] Other proteins in same PDB: d1zt4a1, d1zt4b2, d1zt4b3, d1zt4c1, d1zt4d2, d1zt4d3 automated match to d3hujc1 complexed with agh |
PDB Entry: 1zt4 (more details), 3 Å
SCOPe Domain Sequences for d1zt4c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zt4c2 d.19.1.1 (C:4-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]}
pqrlfplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqw
etlqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgnasnnffhvafqgkdi
lsfqgtsweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk
Timeline for d1zt4c2: