SCOPe 2.08: Domain d1zt4c2: 1zt4 C:4-183

Lineage for d1zt4c2 (1zt4 C:4-183)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
dimeric
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
Class I MHC-related
Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (15 PDB entries)
Domain d1zt4c2: 1zt4 C:4-183 [144766]
Other proteins in same PDB: d1zt4a1, d1zt4b2, d1zt4b3, d1zt4c1, d1zt4d2, d1zt4d3
automated match to d3hujc1
complexed with agh

Details for d1zt4c2

PDB Description: the crystal structure of human cd1d with and without alpha- galactosylceramide

PDB Compounds: (C:) T-cell surface glycoprotein CD1d

SCOPe Domain Sequences for d1zt4c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zt4c2 d.19.1.1 (C:4-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]}
pqrlfplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqw
etlqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgnasnnffhvafqgkdi
lsfqgtsweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk

SCOPe Domain Coordinates for d1zt4c2:

Click to download the PDB-style file with coordinates for d1zt4c2.
(The format of our PDB-style files is described here.)

Timeline for d1zt4c2: