Lineage for d1jdbl1 (1jdb L:2-152)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097883Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2097978Superfamily c.8.3: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52021] (1 family) (S)
    automatically mapped to Pfam PF00988
  5. 2097979Family c.8.3.1: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52022] (1 protein)
  6. 2097980Protein Carbamoyl phosphate synthetase, small subunit N-terminal domain [52023] (1 species)
  7. 2097981Species Escherichia coli [TaxId:562] [52024] (10 PDB entries)
    Uniprot P00907
  8. 2097997Domain d1jdbl1: 1jdb L:2-152 [30759]
    Other proteins in same PDB: d1jdbb1, d1jdbb2, d1jdbb3, d1jdbb4, d1jdbb5, d1jdbb6, d1jdbc2, d1jdbe1, d1jdbe2, d1jdbe3, d1jdbe4, d1jdbe5, d1jdbe6, d1jdbf2, d1jdbh1, d1jdbh2, d1jdbh3, d1jdbh4, d1jdbh5, d1jdbh6, d1jdbi2, d1jdbk1, d1jdbk2, d1jdbk3, d1jdbk4, d1jdbk5, d1jdbk6, d1jdbl2
    complexed with adp, cl, gln, k, mn, net, orn, po4

Details for d1jdbl1

PDB Entry: 1jdb (more details), 2.1 Å

PDB Description: carbamoyl phosphate synthetase from escherichia coli
PDB Compounds: (L:) carbamoyl phosphate synthetase

SCOPe Domain Sequences for d1jdbl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jdbl1 c.8.3.1 (L:2-152) Carbamoyl phosphate synthetase, small subunit N-terminal domain {Escherichia coli [TaxId: 562]}
iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
lrekgaqngciiagdnpdaalalekarafpg

SCOPe Domain Coordinates for d1jdbl1:

Click to download the PDB-style file with coordinates for d1jdbl1.
(The format of our PDB-style files is described here.)

Timeline for d1jdbl1: