Lineage for d1jdbe3 (1jdb E:1-127)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2861873Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)
  6. 2861935Protein Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains [52450] (1 species)
    duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains
  7. 2861936Species Escherichia coli [TaxId:562] [52451] (10 PDB entries)
    Uniprot P00968
  8. 2861979Domain d1jdbe3: 1jdb E:1-127 [31707]
    Other proteins in same PDB: d1jdbb1, d1jdbb2, d1jdbb5, d1jdbb6, d1jdbc1, d1jdbc2, d1jdbe1, d1jdbe2, d1jdbe5, d1jdbe6, d1jdbf1, d1jdbf2, d1jdbh1, d1jdbh2, d1jdbh5, d1jdbh6, d1jdbi1, d1jdbi2, d1jdbk1, d1jdbk2, d1jdbk5, d1jdbk6, d1jdbl1, d1jdbl2
    complexed with adp, cl, gln, k, mn, net, orn, po4

Details for d1jdbe3

PDB Entry: 1jdb (more details), 2.1 Å

PDB Description: carbamoyl phosphate synthetase from escherichia coli
PDB Compounds: (E:) carbamoyl phosphate synthetase

SCOPe Domain Sequences for d1jdbe3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jdbe3 c.30.1.1 (E:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]}
pkrtdiksililgagpivigqacefdysgaqackalreegyrvilvnsnpatimtdpema
datyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigatad
aidkaed

SCOPe Domain Coordinates for d1jdbe3:

Click to download the PDB-style file with coordinates for d1jdbe3.
(The format of our PDB-style files is described here.)

Timeline for d1jdbe3: