Lineage for d1jdbb1 (1jdb B:403-555)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719912Fold a.92: Carbamoyl phosphate synthetase, large subunit connection domain [48107] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    possible duplication: subdomains have similar topologies
  4. 2719913Superfamily a.92.1: Carbamoyl phosphate synthetase, large subunit connection domain [48108] (1 family) (S)
    automatically mapped to Pfam PF02787
  5. 2719914Family a.92.1.1: Carbamoyl phosphate synthetase, large subunit connection domain [48109] (1 protein)
  6. 2719915Protein Carbamoyl phosphate synthetase, large subunit connection domain [48110] (1 species)
  7. 2719916Species Escherichia coli [TaxId:562] [48111] (10 PDB entries)
    Uniprot P00968
  8. 2719937Domain d1jdbb1: 1jdb B:403-555 [18574]
    Other proteins in same PDB: d1jdbb2, d1jdbb3, d1jdbb4, d1jdbb5, d1jdbb6, d1jdbc1, d1jdbc2, d1jdbe2, d1jdbe3, d1jdbe4, d1jdbe5, d1jdbe6, d1jdbf1, d1jdbf2, d1jdbh2, d1jdbh3, d1jdbh4, d1jdbh5, d1jdbh6, d1jdbi1, d1jdbi2, d1jdbk2, d1jdbk3, d1jdbk4, d1jdbk5, d1jdbk6, d1jdbl1, d1jdbl2
    complexed with adp, cl, gln, k, mn, net, orn, po4

Details for d1jdbb1

PDB Entry: 1jdb (more details), 2.1 Å

PDB Description: carbamoyl phosphate synthetase from escherichia coli
PDB Compounds: (B:) carbamoyl phosphate synthetase

SCOPe Domain Sequences for d1jdbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jdbb1 a.92.1.1 (B:403-555) Carbamoyl phosphate synthetase, large subunit connection domain {Escherichia coli [TaxId: 562]}
vgatgfdpkvslddpealtkirrelkdagadriwyiadafraglsvdgvfnltnidrwfl
vqieelvrleekvaevgitglnadflrqlkrkgfadarlaklagvreaeirklrdqydlh
pvykrvdtcaaefatdtaymystyeeeceanps

SCOPe Domain Coordinates for d1jdbb1:

Click to download the PDB-style file with coordinates for d1jdbb1.
(The format of our PDB-style files is described here.)

Timeline for d1jdbb1: