SCOPe 2.08: Domain d1jdbk4: 1jdb K:556-676

Lineage for d1jdbk4 (1jdb K:556-676)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)

6. Protein Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains [52450] (1 species)
   duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains

7. Species Escherichia coli [TaxId:562] [52451] (10 PDB entries)
   Uniprot P00968

8. Domain d1jdbk4: 1jdb K:556-676 [31712]
   Other proteins in same PDB: d1jdbb1, d1jdbb2, d1jdbb5, d1jdbb6, d1jdbc1, d1jdbc2, d1jdbe1, d1jdbe2, d1jdbe5, d1jdbe6, d1jdbf1, d1jdbf2, d1jdbh1, d1jdbh2, d1jdbh5, d1jdbh6, d1jdbi1, d1jdbi2, d1jdbk1, d1jdbk2, d1jdbk5, d1jdbk6, d1jdbl1, d1jdbl2
   complexed with adp, cl, gln, k, mn, net, orn, po4

Details for d1jdbk4

PDB Entry: 1jdb, 2.1 Å

PDB Description: carbamoyl phosphate synthetase from escherichia coli

PDB Compounds: (K:) carbamoyl phosphate synthetase

SCOPe Domain Sequences for d1jdbk4:

Sequence; same for both SEQRES and ATOM records:

>d1jdbk4 c.30.1.1 (K:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]}
tdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvncnpetvstdydtsdrl
yfepvtledvleivriekpkgvivqyggqtplklaraleaagvpvigtspdaidraedre
r

Timeline for d1jdbk4:

• d1jdbk4 first appeared (with stable ids) in SCOP 1.55
  
• d1jdbk4 appears in SCOPe 2.07