SCOPe 2.08: Domain d1um3d2: 1um3 D:46-179

Lineage for d1um3d2 (1um3 D:46-179)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)

Fold b.33: ISP domain [50021] (1 superfamily)
consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

Superfamily b.33.1: ISP domain [50022] (4 families)
Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
Protein automated matches [190874] (7 species)
not a true protein
Species Mastigocladus laminosus [TaxId:83541] [255132] (4 PDB entries)

Domain d1um3d2: 1um3 D:46-179 [303147]
Other proteins in same PDB: d1um3a_, d1um3b_, d1um3d1, d1um3f_, d1um3h_, d1um3n_, d1um3o_, d1um3q1, d1um3s_, d1um3t_, d1um3u_
automated match to d1vf5d1
complexed with bcr, cla, fes, hem, opc, pl9, tds

Details for d1um3d2

PDB Entry: 1um3 (more details), 3 Å

PDB Description: Crystal Structure of Cytochrome b6f Complex from M.laminosus

PDB Compounds: (D:) Rieske iron-sulfur protein

SCOPe Domain Sequences for d1um3d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1um3d2 b.33.1.1 (D:46-179) automated matches {Mastigocladus laminosus [TaxId: 83541]}
sggavgggttakdklgnnvkvskfleshnagdrvlvqglkgdptyivveskeairdygin
avcthlgcvvpwnaaenkfkcpchgsqydetgrvirgpaplslalchatvqddnivltpw
tetdfrtgekpwwv

SCOPe Domain Coordinates for d1um3d2:

Click to download the PDB-style file with coordinates for d1um3d2.
(The format of our PDB-style files is described here.)

Timeline for d1um3d2: