Lineage for d1um3n_ (1um3 N:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577736Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 2577737Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 2577743Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
    a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 2577799Protein automated matches [196844] (6 species)
    not a true protein
  7. 2577813Species Mastigocladus laminosus [TaxId:83541] [196845] (5 PDB entries)
  8. 2577819Domain d1um3n_: 1um3 N: [303150]
    Other proteins in same PDB: d1um3b_, d1um3d1, d1um3d2, d1um3f_, d1um3h_, d1um3o_, d1um3q1, d1um3q2, d1um3s_, d1um3t_, d1um3u_
    automated match to d2e74a_
    complexed with bcr, cla, fes, hem, opc, pl9, tds

Details for d1um3n_

PDB Entry: 1um3 (more details), 3 Å

PDB Description: Crystal Structure of Cytochrome b6f Complex from M.laminosus
PDB Compounds: (N:) Cytochrome b6

SCOPe Domain Sequences for d1um3n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1um3n_ f.21.1.2 (N:) automated matches {Mastigocladus laminosus [TaxId: 83541]}
eiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykptvteayasvqyi
mnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwisgvilavitvsfg
vtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatltryysahtfvlp
wliavfmllhflmirkqgisgp

SCOPe Domain Coordinates for d1um3n_:

Click to download the PDB-style file with coordinates for d1um3n_.
(The format of our PDB-style files is described here.)

Timeline for d1um3n_: