Lineage for d1um3b_ (1um3 B:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2580258Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 2580259Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) (S)
  5. 2580260Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 2580320Protein automated matches [254659] (2 species)
    not a true protein
  7. 2580321Species Mastigocladus laminosus [TaxId:83541] [311181] (1 PDB entry)
  8. 2580322Domain d1um3b_: 1um3 B: [303145]
    Other proteins in same PDB: d1um3a_, d1um3d1, d1um3d2, d1um3f_, d1um3h_, d1um3n_, d1um3q1, d1um3q2, d1um3s_, d1um3t_, d1um3u_
    automated match to d2e74b1
    complexed with bcr, cla, fes, hem, opc, pl9, tds

Details for d1um3b_

PDB Entry: 1um3 (more details), 3 Å

PDB Description: Crystal Structure of Cytochrome b6f Complex from M.laminosus
PDB Compounds: (B:) subunit IV

SCOPe Domain Sequences for d1um3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1um3b_ f.32.1.1 (B:) automated matches {Mastigocladus laminosus [TaxId: 83541]}
lakgmghnyygepawpndllyvfpvvimgtfacivalsvldpamvgepanpfatpleilp
ewylypvfqilrslpnkllgvllmasvplglilvpfienvnkfqnpfrrpvattiflfgt
lvtiwlgigaalpldktl

SCOPe Domain Coordinates for d1um3b_:

Click to download the PDB-style file with coordinates for d1um3b_.
(The format of our PDB-style files is described here.)

Timeline for d1um3b_: