Lineage for d1um3f_ (1um3 F:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2579085Superfamily f.23.25: PetM subunit of the cytochrome b6f complex [103441] (1 family) (S)
  5. 2579086Family f.23.25.1: PetM subunit of the cytochrome b6f complex [103442] (2 proteins)
  6. 2579087Protein PetM subunit of the cytochrome b6f complex [103443] (2 species)
  7. 2579090Species Mastigocladus laminosus [TaxId:83541] [103444] (9 PDB entries)
  8. 2579098Domain d1um3f_: 1um3 F: [303148]
    Other proteins in same PDB: d1um3a_, d1um3b_, d1um3d1, d1um3d2, d1um3h_, d1um3n_, d1um3o_, d1um3q1, d1um3q2, d1um3t_, d1um3u_
    automated match to d1vf5s_
    complexed with bcr, cla, fes, hem, opc, pl9, tds

Details for d1um3f_

PDB Entry: 1um3 (more details), 3 Å

PDB Description: Crystal Structure of Cytochrome b6f Complex from M.laminosus
PDB Compounds: (F:) protein pet m

SCOPe Domain Sequences for d1um3f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1um3f_ f.23.25.1 (F:) PetM subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
mteemlyaallsfglifvgwglgvlllkiqgae

SCOPe Domain Coordinates for d1um3f_:

Click to download the PDB-style file with coordinates for d1um3f_.
(The format of our PDB-style files is described here.)

Timeline for d1um3f_: