Lineage for d1um3d1 (1um3 D:12-45)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2578776Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) (S)
  5. 2578827Family f.23.12.0: automated matches [254198] (1 protein)
    not a true family
  6. 2578828Protein automated matches [254432] (4 species)
    not a true protein
  7. 2578850Species Mastigocladus laminosus [TaxId:83541] [255131] (4 PDB entries)
  8. 2578854Domain d1um3d1: 1um3 D:12-45 [303146]
    Other proteins in same PDB: d1um3a_, d1um3b_, d1um3d2, d1um3f_, d1um3h_, d1um3n_, d1um3o_, d1um3q2, d1um3s_, d1um3t_, d1um3u_
    automated match to d2e76d2
    complexed with bcr, cla, fes, hem, opc, pl9, tds

Details for d1um3d1

PDB Entry: 1um3 (more details), 3 Å

PDB Description: Crystal Structure of Cytochrome b6f Complex from M.laminosus
PDB Compounds: (D:) Rieske iron-sulfur protein

SCOPe Domain Sequences for d1um3d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1um3d1 f.23.12.0 (D:12-45) automated matches {Mastigocladus laminosus [TaxId: 83541]}
dmgrrqfmnllafgtvtgvalgalyplvkyfipp

SCOPe Domain Coordinates for d1um3d1:

Click to download the PDB-style file with coordinates for d1um3d1.
(The format of our PDB-style files is described here.)

Timeline for d1um3d1: