![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
![]() | Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
![]() | Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins) |
![]() | Protein automated matches [190874] (7 species) not a true protein |
![]() | Species Mastigocladus laminosus [TaxId:83541] [255132] (4 PDB entries) |
![]() | Domain d1um3q2: 1um3 Q:46-179 [303153] Other proteins in same PDB: d1um3a_, d1um3b_, d1um3d1, d1um3f_, d1um3h_, d1um3n_, d1um3o_, d1um3q1, d1um3s_, d1um3t_, d1um3u_ automated match to d1vf5d1 complexed with bcr, cla, fes, hem, opc, pl9, tds |
PDB Entry: 1um3 (more details), 3 Å
SCOPe Domain Sequences for d1um3q2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1um3q2 b.33.1.1 (Q:46-179) automated matches {Mastigocladus laminosus [TaxId: 83541]} sggavgggttakdklgnnvkvskfleshnagdrvlvqglkgdptyivveskeairdygin avcthlgcvvpwnaaenkfkcpchgsqydetgrvirgpaplslalchatvqddnivltpw tetdfrtgekpwwv
Timeline for d1um3q2: