SCOP 1.55: Domain d1dlpc2: 1dlp C:116-236

Lineage for d1dlpc2 (1dlp C:116-236)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.78: beta-Prism II [51109] (1 superfamily)

4. Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (1 family)

5. Family b.78.1.1: alpha-D-mannose-specific plant lectins [51111] (2 proteins)

6. Protein Fetuin-binding protein Scafet precursor [51117] (1 species)

7. Species Bluebell (Scilla campanulata) [TaxId:81759] [51118] (1 PDB entry)

8. Domain d1dlpc2: 1dlp C:116-236 [28005]

Details for d1dlpc2

PDB Entry: 1dlp, 3.3 Å

PDB Description: structural characterization of the native fetuin-binding protein scilla campanulata agglutinin (scafet): a novel two-domain lectin

SCOP Domain Sequences for d1dlpc2:

Sequence, based on SEQRES records:

>d1dlpc2 b.78.1.1 (C:116-236) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata)}
gsvvvanngnsilystqgndnhpqtlhatqslqlspyrlsmetdcnlvlfdrddrvwstn
tagkgtgcravlqpngrmdvltnqniavwtsgnsrsagryvfvlqpdrnlaiyggalwtt
g

Sequence, based on observed residues (ATOM records):

>d1dlpc2 b.78.1.1 (C:116-236) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata)}
gsvvvanngnsilystqgnhpqtlhatqslqlspyrlsmetdcnlvlfdrddrvwstnta
gkgtgcravlqpngrmdvltnqniavwtsgnsrsagryvfvlqpdrnlaiyggalwttg

Timeline for d1dlpc2:

• d1dlpc2 appears in SCOP 1.57
  
• d1dlpc2 appears in the current release, SCOPe 2.08