Lineage for d1dlpc2 (1dlp C:116-236)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813364Fold b.78: beta-Prism II [51109] (1 superfamily)
    consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis
    duplication: consists of two domains of this fold
  4. 2813365Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families) (S)
  5. 2813366Family b.78.1.1: alpha-D-mannose-specific plant lectins [51111] (4 proteins)
  6. 2813367Protein Fetuin-binding protein Scafet precursor [51117] (1 species)
    duplication: consists of two beta-prism II domains
  7. 2813368Species Bluebell (Scilla campanulata) [TaxId:81759] [51118] (1 PDB entry)
  8. 2813374Domain d1dlpc2: 1dlp C:116-236 [28005]
    low resolution structure

Details for d1dlpc2

PDB Entry: 1dlp (more details), 3.3 Å

PDB Description: structural characterization of the native fetuin-binding protein scilla campanulata agglutinin (scafet): a novel two-domain lectin
PDB Compounds: (C:) lectin scafet precursor

SCOPe Domain Sequences for d1dlpc2:

Sequence, based on SEQRES records: (download)

>d1dlpc2 b.78.1.1 (C:116-236) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]}
gsvvvanngnsilystqgndnhpqtlhatqslqlspyrlsmetdcnlvlfdrddrvwstn
tagkgtgcravlqpngrmdvltnqniavwtsgnsrsagryvfvlqpdrnlaiyggalwtt
g

Sequence, based on observed residues (ATOM records): (download)

>d1dlpc2 b.78.1.1 (C:116-236) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]}
gsvvvanngnsilystqgnhpqtlhatqslqlspyrlsmetdcnlvlfdrddrvwstnta
gkgtgcravlqpngrmdvltnqniavwtsgnsrsagryvfvlqpdrnlaiyggalwttg

SCOPe Domain Coordinates for d1dlpc2:

Click to download the PDB-style file with coordinates for d1dlpc2.
(The format of our PDB-style files is described here.)

Timeline for d1dlpc2: