Lineage for d1dlpc1 (1dlp C:1-115)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17659Fold b.78: beta-Prism II [51109] (1 superfamily)
  4. 17660Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (1 family) (S)
  5. 17661Family b.78.1.1: alpha-D-mannose-specific plant lectins [51111] (2 proteins)
  6. 17662Protein Fetuin-binding protein Scafet precursor [51117] (1 species)
  7. 17663Species Bluebell (Scilla campanulata) [TaxId:81759] [51118] (1 PDB entry)
  8. 17668Domain d1dlpc1: 1dlp C:1-115 [28004]

Details for d1dlpc1

PDB Entry: 1dlp (more details), 3.3 Å

PDB Description: structural characterization of the native fetuin-binding protein scilla campanulata agglutinin (scafet): a novel two-domain lectin

SCOP Domain Sequences for d1dlpc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlpc1 b.78.1.1 (C:1-115) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata)}
nnilfglshegshpqtlhaaqslelssfrftmqsdcnlvlfdsdvrvwasntagatgcra
vlqsdgllviltaqntirwssgtkgsignyvlvlqpdrtvtiygpglwdsgtsnk

SCOP Domain Coordinates for d1dlpc1:

Click to download the PDB-style file with coordinates for d1dlpc1.
(The format of our PDB-style files is described here.)

Timeline for d1dlpc1: