Lineage for d1dlpe2 (1dlp E:116-235)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17659Fold b.78: beta-Prism II [51109] (1 superfamily)
  4. 17660Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (1 family) (S)
  5. 17661Family b.78.1.1: alpha-D-mannose-specific plant lectins [51111] (2 proteins)
  6. 17662Protein Fetuin-binding protein Scafet precursor [51117] (1 species)
  7. 17663Species Bluebell (Scilla campanulata) [TaxId:81759] [51118] (1 PDB entry)
  8. 17673Domain d1dlpe2: 1dlp E:116-235 [28009]

Details for d1dlpe2

PDB Entry: 1dlp (more details), 3.3 Å

PDB Description: structural characterization of the native fetuin-binding protein scilla campanulata agglutinin (scafet): a novel two-domain lectin

SCOP Domain Sequences for d1dlpe2:

Sequence, based on SEQRES records: (download)

>d1dlpe2 b.78.1.1 (E:116-235) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata)}
gsvvvanngnsilystqgndnhpqtlhatqslqlspyrlsmetdcnlvlfdrddrvwstn
tagkgtgcravlqpngrmdvltnqniavwtsgnsrsagryvfvlqpdrnlaiyggalwtt

Sequence, based on observed residues (ATOM records): (download)

>d1dlpe2 b.78.1.1 (E:116-235) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata)}
gsvvvanngnsilystnhpqtlhatqslqlspyrlsmetdcnlvlfdrddrvwstntagk
gtgcravlqpngrmdvltnqniavwtsgnsrsagryvfvlqpdrnlaiyggalwtt

SCOP Domain Coordinates for d1dlpe2:

Click to download the PDB-style file with coordinates for d1dlpe2.
(The format of our PDB-style files is described here.)

Timeline for d1dlpe2: