![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) ![]() duplication: contains two helix-hairpin-helix (HhH) motifs |
![]() | Family a.60.2.5: Hef domain-like [140629] (4 proteins) helicase/nuclease domain; forms homo and heterodimers; probably includes the Excinuclease UvrC C-terminal domain ((81795), that contains a single NMR structure of a monomeric truncated domain, 1kft) |
![]() | Protein DNA excision repair protein ERCC-1 [140630] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [140631] (3 PDB entries) Uniprot P07992 219-296! Uniprot P07992 220-297 |
![]() | Domain d2muta1: 2mut A:220-297 [274219] Other proteins in same PDB: d2muta2, d2muta3, d2mutb_ automated match to d1z00a1 mutant |
PDB Entry: 2mut (more details)
SCOPe Domain Sequences for d2muta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2muta1 a.60.2.5 (A:220-297) DNA excision repair protein ERCC-1 {Human (Homo sapiens) [TaxId: 9606]} adllmekleqdlvsrvteclttvksvnktdsqtllttfgsleqliaasredlalcpglgp qkarrlfdvlhepflkvp
Timeline for d2muta1: