PDB entry 2mut

View 2mut on RCSB PDB site
Description: Solution structure of the F231L mutant ERCC1-XPF dimerization region
Class: hydrolase
Keywords: ERCC1-XPF, F231L, Nucleotide Excision Repair, HYDROLASE
Deposited on 2014-09-17, released 2015-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-26, with a file datestamp of 2015-08-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA excision repair protein ERCC-1
  Species: Homo sapiens [TaxId:9606]
  Gene: ERCC1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07992 (8-85)
    • expression tag (0-7)
    • engineered mutation (19)
    • expression tag (86-95)
  Domains in SCOPe 2.07: d2muta1, d2muta2, d2muta3
• Chain 'B':
  Compound: DNA repair endonuclease XPF
  Species: Homo sapiens [TaxId:9606]
  Gene: ERCC4, ERCC11, XPF
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q92889 (1-83)
    • initiating methionine (0)
  Domains in SCOPe 2.07: d2mutb_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2mutA (A:)
  rirrrynmadllmekleqdlvsrvteclttvksvnktdsqtllttfgsleqliaasredl
  alcpglgpqkarrlfdvlhepflkvpgglehhhhhh
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2mutB (B:)
  mdsetlpesekynpgpqdfllkmpgvnakncrslmhhvkniaelaalsqdeltsilgnaa
  nakqlydfihtsfaevvskgkgkk